Anti ERI3 pAb (ATL-HPA029895)

Atlas Antibodies

SKU: ATL-HPA029895-100

• 
• 
• 

Protein Description: ERI1 exoribonuclease family member 3
Gene Name: ERI3
Alternative Gene Name: FLJ22943, PINT1, PRNPIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033423: 99%, ENSRNOG00000019381: 99%
Entrez Gene ID: 79033
Uniprot ID: O43414
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPVVHPQLTPFCTELTGIIQAMVDGQPSLQQVLERVDEWMAKEGLLDPNVKSIFVTCGDWDLKVMLPGQCQYLGLPVADYFKQWI
• Gene Sequence: QPVVHPQLTPFCTELTGIIQAMVDGQPSLQQVLERVDEWMAKEGLLDPNVKSIFVTCGDWDLKVMLPGQCQYLGLPVADYFKQWI
• Gene ID - Mouse: ENSMUSG00000033423
• Gene ID - Rat: ENSRNOG00000019381
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.