Anti ERH pAb (ATL-HPA002567)

Atlas Antibodies

SKU: ATL-HPA002567-25

• 
• 
• 

Protein Description: enhancer of rudimentary homolog (Drosophila)
Gene Name: ERH
Alternative Gene Name: DROER
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063412: 100%, ENSRNOG00000004883: 100%
Entrez Gene ID: 2079
Uniprot ID: P84090
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
• Gene Sequence: LVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
• Gene ID - Mouse: ENSMUSG00000063412
• Gene ID - Rat: ENSRNOG00000004883
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ERH pAb (ATL-HPA002567) – 5 Found

Malvi, Parmanand; Wang, Biao; Shah, Shreni; Gupta, Romi. Dissecting the role of RNA modification regulatory proteins in melanoma. Oncotarget. 2019;10(38):3745-3759. 

Pang, Kun; Dong, Yang; Hao, Lin; Shi, Zhen-Duo; Zhang, Zhi-Guo; Chen, Bo; Feng, Harry; Ma, Yu-Yang; Xu, Hao; Pan, Deng; Chen, Zhe-Sheng; Han, Cong-Hui. ERH Interacts With EIF2α and Regulates the EIF2α/ATF4/CHOP Pathway in Bladder Cancer Cells. Frontiers In Oncology. 12( 35774124):871687. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Lee, Jonathan D; Paulo, Joao A; Posey, Ryan R; Mugoni, Vera; Kong, Nikki R; Cheloni, Giulia; Lee, Yu-Ru; Slack, Frank J; Tenen, Daniel G; Clohessy, John G; Gygi, Steven P; Pandolfi, Pier Paolo. Dual DNA and protein tagging of open chromatin unveils dynamics of epigenomic landscapes in leukemia. Nature Methods. 2021;18(3):293-302. 

McCarthy, Ryan L; Kaeding, Kelsey E; Keller, Samuel H; Zhong, Yu; Xu, Liqin; Hsieh, Antony; Hou, Yong; Donahue, Greg; Becker, Justin S; Alberto, Oscar; Lim, Bomyi; Zaret, Kenneth S. Diverse heterochromatin-associated proteins repress distinct classes of genes and repetitive elements. Nature Cell Biology. 2021;23(8):905-914.