Anti ERGIC3 pAb (ATL-HPA015968)

Atlas Antibodies

Catalog No.: ATL-HPA015968-100

Protein Description: ERGIC and golgi 3
Gene Name: ERGIC3
Alternative Gene Name: C20orf47, CGI-54, Erv46, NY-BR-84, PRO0989, SDBCAG84
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005881: 99%, ENSRNOG00000031085: 99%
Entrez Gene ID: 51614
Uniprot ID: Q9Y282
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKH
• Gene Sequence: NINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKH
• Gene ID - Mouse: ENSMUSG00000005881
• Gene ID - Rat: ENSRNOG00000031085
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.