Anti ERGIC3 pAb (ATL-HPA015968)

Atlas Antibodies

Catalog No.:
ATL-HPA015968-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: ERGIC and golgi 3
Gene Name: ERGIC3
Alternative Gene Name: C20orf47, CGI-54, Erv46, NY-BR-84, PRO0989, SDBCAG84
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005881: 99%, ENSRNOG00000031085: 99%
Entrez Gene ID: 51614
Uniprot ID: Q9Y282
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKH
Gene Sequence NINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKH
Gene ID - Mouse ENSMUSG00000005881
Gene ID - Rat ENSRNOG00000031085
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ERGIC3 pAb (ATL-HPA015968)
Datasheet Anti ERGIC3 pAb (ATL-HPA015968) Datasheet (External Link)
Vendor Page Anti ERGIC3 pAb (ATL-HPA015968) at Atlas Antibodies

Documents & Links for Anti ERGIC3 pAb (ATL-HPA015968)
Datasheet Anti ERGIC3 pAb (ATL-HPA015968) Datasheet (External Link)
Vendor Page Anti ERGIC3 pAb (ATL-HPA015968)