Anti ERGIC1 pAb (ATL-HPA018900 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA018900-100
  • Immunohistochemical staining of human cerebral cortex, liver, prostate and testis using Anti-ERGIC1 antibody HPA018900 (A) shows similar protein distribution across tissues to independent antibody HPA018666 (B).
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ERGIC1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY422162).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: endoplasmic reticulum-golgi intermediate compartment (ERGIC) 1
Gene Name: ERGIC1
Alternative Gene Name: ERGIC-32, ERGIC32, KIAA1181, NET24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001576: 97%, ENSRNOG00000003508: 97%
Entrez Gene ID: 57222
Uniprot ID: Q969X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGNFHVSTHSATAQPQNPDMTHVIHKLSFGDTLQVQNIHGAFNALGGADRLTSNPLASHDYIL
Gene Sequence PGNFHVSTHSATAQPQNPDMTHVIHKLSFGDTLQVQNIHGAFNALGGADRLTSNPLASHDYIL
Gene ID - Mouse ENSMUSG00000001576
Gene ID - Rat ENSRNOG00000003508
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ERGIC1 pAb (ATL-HPA018900 w/enhanced validation)
Datasheet Anti ERGIC1 pAb (ATL-HPA018900 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ERGIC1 pAb (ATL-HPA018900 w/enhanced validation)



Citations for Anti ERGIC1 pAb (ATL-HPA018900 w/enhanced validation) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed