Anti ERGIC1 pAb (ATL-HPA018666 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA018666-100

• 
• 
• 

Protein Description: endoplasmic reticulum-golgi intermediate compartment (ERGIC) 1
Gene Name: ERGIC1
Alternative Gene Name: ERGIC-32, ERGIC32, KIAA1181, NET24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001576: 100%, ENSRNOG00000003508: 99%
Entrez Gene ID: 57222
Uniprot ID: Q969X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVNELYVDDPDKDSGGKIDVSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQFSINK
• Gene Sequence: VVNELYVDDPDKDSGGKIDVSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQFSINK
• Gene ID - Mouse: ENSMUSG00000001576
• Gene ID - Rat: ENSRNOG00000003508
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.