Anti ERFE pAb (ATL-HPA077259)

Atlas Antibodies

Catalog No.:
ATL-HPA077259-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: erythroferrone
Gene Name: ERFE
Alternative Gene Name: C1QTNF15, CTRP15, FAM132B, FLJ37034
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047443: 74%, ENSRNOG00000024688: 79%
Entrez Gene ID: 151176
Uniprot ID: Q4G0M1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence EPTAERAHSVDPRDAWMLFVRQSDKGVNGKKRSRGKAKKLKFGLPGP
Gene ID - Mouse ENSMUSG00000047443
Gene ID - Rat ENSMUSG00000047443
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ERFE pAb (ATL-HPA077259)
Datasheet Anti ERFE pAb (ATL-HPA077259) Datasheet (External Link)
Vendor Page Anti ERFE pAb (ATL-HPA077259) at Atlas Antibodies

Documents & Links for Anti ERFE pAb (ATL-HPA077259)
Datasheet Anti ERFE pAb (ATL-HPA077259) Datasheet (External Link)
Vendor Page Anti ERFE pAb (ATL-HPA077259)