Anti ERCC6L2 pAb (ATL-HPA021260)

Atlas Antibodies

SKU:
ATL-HPA021260-25
  • Immunohistochemical staining of human pancreas shows strong positivity in exocrine pancreas.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: excision repair cross-complementation group 6-like 2
Gene Name: ERCC6L2
Alternative Gene Name: C9orf102, FLJ37706, RAD26L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021470: 55%, ENSRNOG00000019175: 57%
Entrez Gene ID: 375748
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SYFNSSSVNEFAKHITNATSEERQKMLRDFYASQYPEVKEFFVDSVSQFNNSSFEKGEQRTRKKSDKRESLIKPRLSDSETLSFKDSTN
Gene Sequence SYFNSSSVNEFAKHITNATSEERQKMLRDFYASQYPEVKEFFVDSVSQFNNSSFEKGEQRTRKKSDKRESLIKPRLSDSETLSFKDSTN
Gene ID - Mouse ENSMUSG00000021470
Gene ID - Rat ENSRNOG00000019175
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ERCC6L2 pAb (ATL-HPA021260)
Datasheet Anti ERCC6L2 pAb (ATL-HPA021260) Datasheet (External Link)
Vendor Page Anti ERCC6L2 pAb (ATL-HPA021260) at Atlas Antibodies

Documents & Links for Anti ERCC6L2 pAb (ATL-HPA021260)
Datasheet Anti ERCC6L2 pAb (ATL-HPA021260) Datasheet (External Link)
Vendor Page Anti ERCC6L2 pAb (ATL-HPA021260)