Anti ERCC5 pAb (ATL-HPA045845)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045845-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ERCC5
Alternative Gene Name: ERCM2, XPGC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026048: 83%, ENSRNOG00000022812: 83%
Entrez Gene ID: 2073
Uniprot ID: P28715
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DDFSQYQLKGLLKKNYLNQHIEHVQKEMNQQHSGHIRRQYEDEGGFLKEVESRRVVSEDTSHYILIKGIQAKTVAEVDSESLPSSSKMHGMSFDVKSSPCE |
Gene Sequence | DDFSQYQLKGLLKKNYLNQHIEHVQKEMNQQHSGHIRRQYEDEGGFLKEVESRRVVSEDTSHYILIKGIQAKTVAEVDSESLPSSSKMHGMSFDVKSSPCE |
Gene ID - Mouse | ENSMUSG00000026048 |
Gene ID - Rat | ENSRNOG00000022812 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ERCC5 pAb (ATL-HPA045845) | |
Datasheet | Anti ERCC5 pAb (ATL-HPA045845) Datasheet (External Link) |
Vendor Page | Anti ERCC5 pAb (ATL-HPA045845) at Atlas Antibodies |
Documents & Links for Anti ERCC5 pAb (ATL-HPA045845) | |
Datasheet | Anti ERCC5 pAb (ATL-HPA045845) Datasheet (External Link) |
Vendor Page | Anti ERCC5 pAb (ATL-HPA045845) |