Anti ERCC4 pAb (ATL-HPA045828)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045828-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ERCC4
Alternative Gene Name: FANCQ, RAD1, XPF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022545: 75%, ENSRNOG00000053079: 74%
Entrez Gene ID: 2072
Uniprot ID: Q92889
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SKPQPDAATALAITADSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGK |
Gene Sequence | SKPQPDAATALAITADSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGK |
Gene ID - Mouse | ENSMUSG00000022545 |
Gene ID - Rat | ENSRNOG00000053079 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ERCC4 pAb (ATL-HPA045828) | |
Datasheet | Anti ERCC4 pAb (ATL-HPA045828) Datasheet (External Link) |
Vendor Page | Anti ERCC4 pAb (ATL-HPA045828) at Atlas Antibodies |
Documents & Links for Anti ERCC4 pAb (ATL-HPA045828) | |
Datasheet | Anti ERCC4 pAb (ATL-HPA045828) Datasheet (External Link) |
Vendor Page | Anti ERCC4 pAb (ATL-HPA045828) |