Anti ERC1 pAb (ATL-HPA024130 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA024130-25
  • Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
  • Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.
  • Western blot analysis using Anti-ERC1 antibody HPA024130 (A) shows similar pattern to independent antibody HPA019513 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ELKS/RAB6-interacting/CAST family member 1
Gene Name: ERC1
Alternative Gene Name: CAST2, ELKS, KIAA1081, MGC12974, RAB6IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030172: 94%, ENSRNOG00000009264: 94%
Entrez Gene ID: 23085
Uniprot ID: Q8IUD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen EEREEEMKQMEVYRSHSKFMKNKVEQLKEELSSKEAQWEELKKKAAGLQAEIGQVKQELSRKDTELLALQTKLETLINQFSD
Gene Sequence EEREEEMKQMEVYRSHSKFMKNKVEQLKEELSSKEAQWEELKKKAAGLQAEIGQVKQELSRKDTELLALQTKLETLINQFSD
Gene ID - Mouse ENSMUSG00000030172
Gene ID - Rat ENSRNOG00000009264
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ERC1 pAb (ATL-HPA024130 w/enhanced validation)
Datasheet Anti ERC1 pAb (ATL-HPA024130 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ERC1 pAb (ATL-HPA024130 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ERC1 pAb (ATL-HPA024130 w/enhanced validation)
Datasheet Anti ERC1 pAb (ATL-HPA024130 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ERC1 pAb (ATL-HPA024130 w/enhanced validation)