Anti ERC1 pAb (ATL-HPA019523)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019523-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ERC1
Alternative Gene Name: CAST2, ELKS, KIAA1081, MGC12974, RAB6IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030172: 100%, ENSRNOG00000009264: 100%
Entrez Gene ID: 23085
Uniprot ID: Q8IUD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVK |
| Gene Sequence | TPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVK |
| Gene ID - Mouse | ENSMUSG00000030172 |
| Gene ID - Rat | ENSRNOG00000009264 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ERC1 pAb (ATL-HPA019523) | |
| Datasheet | Anti ERC1 pAb (ATL-HPA019523) Datasheet (External Link) |
| Vendor Page | Anti ERC1 pAb (ATL-HPA019523) at Atlas Antibodies |
| Documents & Links for Anti ERC1 pAb (ATL-HPA019523) | |
| Datasheet | Anti ERC1 pAb (ATL-HPA019523) Datasheet (External Link) |
| Vendor Page | Anti ERC1 pAb (ATL-HPA019523) |
| Citations for Anti ERC1 pAb (ATL-HPA019523) – 1 Found |
| Myllymäki, Satu-Marja; Kämäräinen, Ulla-Reetta; Liu, Xiaonan; Cruz, Sara Pereira; Miettinen, Sini; Vuorela, Mikko; Varjosalo, Markku; Manninen, Aki. Assembly of the β4-Integrin Interactome Based on Proximal Biotinylation in the Presence and Absence of Heterodimerization. Molecular & Cellular Proteomics : Mcp. 2019;18(2):277-293. PubMed |