Anti ERC1 pAb (ATL-HPA019523)

Atlas Antibodies

SKU: ATL-HPA019523-25

• 
• 
• 

Protein Description: ELKS/RAB6-interacting/CAST family member 1
Gene Name: ERC1
Alternative Gene Name: CAST2, ELKS, KIAA1081, MGC12974, RAB6IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030172: 100%, ENSRNOG00000009264: 100%
Entrez Gene ID: 23085
Uniprot ID: Q8IUD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVK
• Gene Sequence: TPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVASDTIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVK
• Gene ID - Mouse: ENSMUSG00000030172
• Gene ID - Rat: ENSRNOG00000009264
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ERC1 pAb (ATL-HPA019523) – 1 Found

Myllymäki, Satu-Marja; Kämäräinen, Ulla-Reetta; Liu, Xiaonan; Cruz, Sara Pereira; Miettinen, Sini; Vuorela, Mikko; Varjosalo, Markku; Manninen, Aki. Assembly of the β4-Integrin Interactome Based on Proximal Biotinylation in the Presence and Absence of Heterodimerization. Molecular & Cellular Proteomics : Mcp. 2019;18(2):277-293.