Anti ERC1 pAb (ATL-HPA019513 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA019513-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ERC1
Alternative Gene Name: CAST2, ELKS, KIAA1081, MGC12974, RAB6IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030172: 89%, ENSRNOG00000009264: 89%
Entrez Gene ID: 23085
Uniprot ID: Q8IUD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IIQPLLELDQNRSKLKLYIGHLTTLCHDRDPLILRGLTPPASYNLDDDQAAWENELQKMTRGQLQDELEKGERDNAELQEFANAILQQIADHCPD |
Gene Sequence | IIQPLLELDQNRSKLKLYIGHLTTLCHDRDPLILRGLTPPASYNLDDDQAAWENELQKMTRGQLQDELEKGERDNAELQEFANAILQQIADHCPD |
Gene ID - Mouse | ENSMUSG00000030172 |
Gene ID - Rat | ENSRNOG00000009264 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ERC1 pAb (ATL-HPA019513 w/enhanced validation) | |
Datasheet | Anti ERC1 pAb (ATL-HPA019513 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ERC1 pAb (ATL-HPA019513 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ERC1 pAb (ATL-HPA019513 w/enhanced validation) | |
Datasheet | Anti ERC1 pAb (ATL-HPA019513 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ERC1 pAb (ATL-HPA019513 w/enhanced validation) |
Citations for Anti ERC1 pAb (ATL-HPA019513 w/enhanced validation) – 1 Found |
Ripamonti, Marta; Lamarca, Andrea; Davey, Norman E; Tonoli, Diletta; Surini, Sara; de Curtis, Ivan. A functional interaction between liprin-α1 and B56γ regulatory subunit of protein phosphatase 2A supports tumor cell motility. Communications Biology. 2022;5(1):1025. PubMed |