Anti ERBB3 pAb (ATL-HPA045396)

Atlas Antibodies

SKU: ATL-HPA045396-25

• 
• 

Protein Description: v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 3
Gene Name: ERBB3
Alternative Gene Name: HER3, LCCS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018166: 78%, ENSRNOG00000004964: 77%
Entrez Gene ID: 2065
Uniprot ID: P21860
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCR
• Gene Sequence: LATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPRPVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCR
• Gene ID - Mouse: ENSMUSG00000018166
• Gene ID - Rat: ENSRNOG00000004964
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.