Anti ERAL1 pAb (ATL-HPA021425 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA021425-25
  • Immunohistochemical staining of human gallbladder shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
  • Western blot analysis using Anti-ERAL1 antibody HPA021425 (A) shows similar pattern to independent antibody HPA024423 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Era-like 12S mitochondrial rRNA chaperone 1
Gene Name: ERAL1
Alternative Gene Name: HERA-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020832: 81%, ENSRNOG00000010673: 80%
Entrez Gene ID: 26284
Uniprot ID: O75616
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PWEYHSAVLTSQTPEEICANIIREKLLEHLPQEVPYNVQQKTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLMDIFLCDVDIRLSVKLLK
Gene Sequence PWEYHSAVLTSQTPEEICANIIREKLLEHLPQEVPYNVQQKTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLMDIFLCDVDIRLSVKLLK
Gene ID - Mouse ENSMUSG00000020832
Gene ID - Rat ENSRNOG00000010673
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ERAL1 pAb (ATL-HPA021425 w/enhanced validation)
Datasheet Anti ERAL1 pAb (ATL-HPA021425 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ERAL1 pAb (ATL-HPA021425 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ERAL1 pAb (ATL-HPA021425 w/enhanced validation)
Datasheet Anti ERAL1 pAb (ATL-HPA021425 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ERAL1 pAb (ATL-HPA021425 w/enhanced validation)