Anti EQTN pAb (ATL-HPA015089 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA015089-25
  • Immunohistochemistry analysis in human testis and prostate tissues using HPA015089 antibody. Corresponding EQTN RNA-seq data are presented for the same tissues.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and EQTN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY431817).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: equatorin, sperm acrosome associated
Gene Name: EQTN
Alternative Gene Name: AFAF, C9orf11, equatorin, SPACA8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028575: 61%, ENSRNOG00000026323: 33%
Entrez Gene ID: 54586
Uniprot ID: Q9NQ60
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SCESQYSVNPELATMSYFHPSEGVSDTSFSKSAESSTFLGTTSSDMRRSGTRTSESKIMTDIISIGSDNEMHENDESVTR
Gene Sequence SCESQYSVNPELATMSYFHPSEGVSDTSFSKSAESSTFLGTTSSDMRRSGTRTSESKIMTDIISIGSDNEMHENDESVTR
Gene ID - Mouse ENSMUSG00000028575
Gene ID - Rat ENSRNOG00000026323
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EQTN pAb (ATL-HPA015089 w/enhanced validation)
Datasheet Anti EQTN pAb (ATL-HPA015089 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EQTN pAb (ATL-HPA015089 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti EQTN pAb (ATL-HPA015089 w/enhanced validation)
Datasheet Anti EQTN pAb (ATL-HPA015089 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EQTN pAb (ATL-HPA015089 w/enhanced validation)



Citations for Anti EQTN pAb (ATL-HPA015089 w/enhanced validation) – 1 Found
Fagerberg, Linn; Oksvold, Per; Skogs, Marie; Algenäs, Cajsa; Lundberg, Emma; Pontén, Fredrik; Sivertsson, Asa; Odeberg, Jacob; Klevebring, Daniel; Kampf, Caroline; Asplund, Anna; Sjöstedt, Evelina; Al-Khalili Szigyarto, Cristina; Edqvist, Per-Henrik; Olsson, Ingmarie; Rydberg, Urban; Hudson, Paul; Ottosson Takanen, Jenny; Berling, Holger; Björling, Lisa; Tegel, Hanna; Rockberg, Johan; Nilsson, Peter; Navani, Sanjay; Jirström, Karin; Mulder, Jan; Schwenk, Jochen M; Zwahlen, Martin; Hober, Sophia; Forsberg, Mattias; von Feilitzen, Kalle; Uhlén, Mathias. Contribution of antibody-based protein profiling to the human Chromosome-centric Proteome Project (C-HPP). Journal Of Proteome Research. 2013;12(6):2439-48.  PubMed