Anti EPSTI1 pAb (ATL-HPA017362)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017362-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: EPSTI1
Alternative Gene Name: BRESI1, MGC29634
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022014: 71%, ENSRNOG00000009471: 70%
Entrez Gene ID: 94240
Uniprot ID: Q96J88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ARSWAYRDSLKAEENRKLQKMKDEQHQKSELLELKRQQQEQERAKIHQTEHRRVNNAFLDRLQGKSQPGGLEQSGGCWNMNSGNSW |
| Gene Sequence | ARSWAYRDSLKAEENRKLQKMKDEQHQKSELLELKRQQQEQERAKIHQTEHRRVNNAFLDRLQGKSQPGGLEQSGGCWNMNSGNSW |
| Gene ID - Mouse | ENSMUSG00000022014 |
| Gene ID - Rat | ENSRNOG00000009471 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EPSTI1 pAb (ATL-HPA017362) | |
| Datasheet | Anti EPSTI1 pAb (ATL-HPA017362) Datasheet (External Link) |
| Vendor Page | Anti EPSTI1 pAb (ATL-HPA017362) at Atlas Antibodies |
| Documents & Links for Anti EPSTI1 pAb (ATL-HPA017362) | |
| Datasheet | Anti EPSTI1 pAb (ATL-HPA017362) Datasheet (External Link) |
| Vendor Page | Anti EPSTI1 pAb (ATL-HPA017362) |
| Citations for Anti EPSTI1 pAb (ATL-HPA017362) – 1 Found |
| Li, T; Lu, H; Shen, C; Lahiri, S K; Wason, M S; Mukherjee, D; Yu, L; Zhao, J. Identification of epithelial stromal interaction 1 as a novel effector downstream of Krüppel-like factor 8 in breast cancer invasion and metastasis. Oncogene. 2014;33(39):4746-55. PubMed |