Anti EPSTI1 pAb (ATL-HPA017362)

Atlas Antibodies

Catalog No.:
ATL-HPA017362-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: epithelial stromal interaction 1 (breast)
Gene Name: EPSTI1
Alternative Gene Name: BRESI1, MGC29634
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022014: 71%, ENSRNOG00000009471: 70%
Entrez Gene ID: 94240
Uniprot ID: Q96J88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ARSWAYRDSLKAEENRKLQKMKDEQHQKSELLELKRQQQEQERAKIHQTEHRRVNNAFLDRLQGKSQPGGLEQSGGCWNMNSGNSW
Gene Sequence ARSWAYRDSLKAEENRKLQKMKDEQHQKSELLELKRQQQEQERAKIHQTEHRRVNNAFLDRLQGKSQPGGLEQSGGCWNMNSGNSW
Gene ID - Mouse ENSMUSG00000022014
Gene ID - Rat ENSRNOG00000009471
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPSTI1 pAb (ATL-HPA017362)
Datasheet Anti EPSTI1 pAb (ATL-HPA017362) Datasheet (External Link)
Vendor Page Anti EPSTI1 pAb (ATL-HPA017362) at Atlas Antibodies

Documents & Links for Anti EPSTI1 pAb (ATL-HPA017362)
Datasheet Anti EPSTI1 pAb (ATL-HPA017362) Datasheet (External Link)
Vendor Page Anti EPSTI1 pAb (ATL-HPA017362)
Citations for Anti EPSTI1 pAb (ATL-HPA017362) – 1 Found
Li, T; Lu, H; Shen, C; Lahiri, S K; Wason, M S; Mukherjee, D; Yu, L; Zhao, J. Identification of epithelial stromal interaction 1 as a novel effector downstream of Krüppel-like factor 8 in breast cancer invasion and metastasis. Oncogene. 2014;33(39):4746-55.  PubMed