Anti EPS8L3 pAb (ATL-HPA030998)

Atlas Antibodies

Catalog No.:
ATL-HPA030998-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: EPS8-like 3
Gene Name: EPS8L3
Alternative Gene Name: FLJ21522, MGC16817
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040600: 78%, ENSRNOG00000058242: 78%
Entrez Gene ID: 79574
Uniprot ID: Q8TE67
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WLVKNEAGRSGYIPSNILEPLQPGTPGTQGQSPSRVPMLRLSSRPEEVTDWLQAENFSTATVRTLGSLTGSQLLRIRPGELQMLCPQE
Gene Sequence WLVKNEAGRSGYIPSNILEPLQPGTPGTQGQSPSRVPMLRLSSRPEEVTDWLQAENFSTATVRTLGSLTGSQLLRIRPGELQMLCPQE
Gene ID - Mouse ENSMUSG00000040600
Gene ID - Rat ENSRNOG00000058242
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPS8L3 pAb (ATL-HPA030998)
Datasheet Anti EPS8L3 pAb (ATL-HPA030998) Datasheet (External Link)
Vendor Page Anti EPS8L3 pAb (ATL-HPA030998) at Atlas Antibodies

Documents & Links for Anti EPS8L3 pAb (ATL-HPA030998)
Datasheet Anti EPS8L3 pAb (ATL-HPA030998) Datasheet (External Link)
Vendor Page Anti EPS8L3 pAb (ATL-HPA030998)