Anti EPS8L2 pAb (ATL-HPA041143 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041143-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EPS8L2
Alternative Gene Name: FLJ21935, FLJ22171, MGC3088
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025504: 83%, ENSRNOG00000018336: 82%
Entrez Gene ID: 64787
Uniprot ID: Q9H6S3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SVSCPLLSRDAVDFLRGHLVPKEMSLWESLGESWMRPRSEWPREPQVPLYVPKFHSGWEPPVDVLQEAPWEVEGLASAPIEEVSPVSR |
Gene Sequence | SVSCPLLSRDAVDFLRGHLVPKEMSLWESLGESWMRPRSEWPREPQVPLYVPKFHSGWEPPVDVLQEAPWEVEGLASAPIEEVSPVSR |
Gene ID - Mouse | ENSMUSG00000025504 |
Gene ID - Rat | ENSRNOG00000018336 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EPS8L2 pAb (ATL-HPA041143 w/enhanced validation) | |
Datasheet | Anti EPS8L2 pAb (ATL-HPA041143 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti EPS8L2 pAb (ATL-HPA041143 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti EPS8L2 pAb (ATL-HPA041143 w/enhanced validation) | |
Datasheet | Anti EPS8L2 pAb (ATL-HPA041143 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti EPS8L2 pAb (ATL-HPA041143 w/enhanced validation) |
Citations for Anti EPS8L2 pAb (ATL-HPA041143 w/enhanced validation) – 1 Found |
Calero-Cuenca, Francisco J; Osorio, Daniel S; Carvalho-Marques, Sofia; Sridhara, Sreerama Chaitanya; Oliveira, Luis M; Jiao, Yue; Diaz, Jheimmy; Janota, Cátia S; Cadot, Bruno; Gomes, Edgar R. Ctdnep1 and Eps8L2 regulate dorsal actin cables for nuclear positioning during cell migration. Current Biology : Cb. 2021;31(7):1521-1530.e8. PubMed |