Anti EPS8L2 pAb (ATL-HPA041143 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA041143-25

• 
• 
• 

Protein Description: EPS8-like 2
Gene Name: EPS8L2
Alternative Gene Name: FLJ21935, FLJ22171, MGC3088
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025504: 83%, ENSRNOG00000018336: 82%
Entrez Gene ID: 64787
Uniprot ID: Q9H6S3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVSCPLLSRDAVDFLRGHLVPKEMSLWESLGESWMRPRSEWPREPQVPLYVPKFHSGWEPPVDVLQEAPWEVEGLASAPIEEVSPVSR
• Gene Sequence: SVSCPLLSRDAVDFLRGHLVPKEMSLWESLGESWMRPRSEWPREPQVPLYVPKFHSGWEPPVDVLQEAPWEVEGLASAPIEEVSPVSR
• Gene ID - Mouse: ENSMUSG00000025504
• Gene ID - Rat: ENSRNOG00000018336
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EPS8L2 pAb (ATL-HPA041143 w/enhanced validation) – 1 Found

Calero-Cuenca, Francisco J; Osorio, Daniel S; Carvalho-Marques, Sofia; Sridhara, Sreerama Chaitanya; Oliveira, Luis M; Jiao, Yue; Diaz, Jheimmy; Janota, Cátia S; Cadot, Bruno; Gomes, Edgar R. Ctdnep1 and Eps8L2 regulate dorsal actin cables for nuclear positioning during cell migration. Current Biology : Cb. 2021;31(7):1521-1530.e8.