Anti EPN2 pAb (ATL-HPA053360)

Atlas Antibodies

Catalog No.:
ATL-HPA053360-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: epsin 2
Gene Name: EPN2
Alternative Gene Name: EHB21, KIAA1065
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001036: 92%, ENSRNOG00000060550: 92%
Entrez Gene ID: 22905
Uniprot ID: O95208
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLGQSEELQPLSQRHPFLPHLGLASRPNGDWSQPCLTCDRAARATSPRVSSEL
Gene Sequence PLGQSEELQPLSQRHPFLPHLGLASRPNGDWSQPCLTCDRAARATSPRVSSEL
Gene ID - Mouse ENSMUSG00000001036
Gene ID - Rat ENSRNOG00000060550
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPN2 pAb (ATL-HPA053360)
Datasheet Anti EPN2 pAb (ATL-HPA053360) Datasheet (External Link)
Vendor Page Anti EPN2 pAb (ATL-HPA053360) at Atlas Antibodies

Documents & Links for Anti EPN2 pAb (ATL-HPA053360)
Datasheet Anti EPN2 pAb (ATL-HPA053360) Datasheet (External Link)
Vendor Page Anti EPN2 pAb (ATL-HPA053360)