Anti EPHX4 pAb (ATL-HPA035067)

Atlas Antibodies

SKU: ATL-HPA035067-25

• 
• 

Protein Description: epoxide hydrolase 4
Gene Name: EPHX4
Alternative Gene Name: ABHD7, EPHXRP, FLJ90341
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033805: 88%, ENSRNOG00000023389: 85%
Entrez Gene ID: 253152
Uniprot ID: Q8IUS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FPHPNVFTEYILRHPAQLLKSSYYYFFQIPWFPEFMFSINDFKVLKHLFTSHSTGIGRKGCQLTTEDLEAYIYVF
• Gene Sequence: FPHPNVFTEYILRHPAQLLKSSYYYFFQIPWFPEFMFSINDFKVLKHLFTSHSTGIGRKGCQLTTEDLEAYIYVF
• Gene ID - Mouse: ENSMUSG00000033805
• Gene ID - Rat: ENSRNOG00000023389
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.