Anti EPHX4 pAb (ATL-HPA035067)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035067-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EPHX4
Alternative Gene Name: ABHD7, EPHXRP, FLJ90341
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033805: 88%, ENSRNOG00000023389: 85%
Entrez Gene ID: 253152
Uniprot ID: Q8IUS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FPHPNVFTEYILRHPAQLLKSSYYYFFQIPWFPEFMFSINDFKVLKHLFTSHSTGIGRKGCQLTTEDLEAYIYVF |
Gene Sequence | FPHPNVFTEYILRHPAQLLKSSYYYFFQIPWFPEFMFSINDFKVLKHLFTSHSTGIGRKGCQLTTEDLEAYIYVF |
Gene ID - Mouse | ENSMUSG00000033805 |
Gene ID - Rat | ENSRNOG00000023389 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EPHX4 pAb (ATL-HPA035067) | |
Datasheet | Anti EPHX4 pAb (ATL-HPA035067) Datasheet (External Link) |
Vendor Page | Anti EPHX4 pAb (ATL-HPA035067) at Atlas Antibodies |
Documents & Links for Anti EPHX4 pAb (ATL-HPA035067) | |
Datasheet | Anti EPHX4 pAb (ATL-HPA035067) Datasheet (External Link) |
Vendor Page | Anti EPHX4 pAb (ATL-HPA035067) |