Anti EPHX4 pAb (ATL-HPA035067)

Atlas Antibodies

Catalog No.:
ATL-HPA035067-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: epoxide hydrolase 4
Gene Name: EPHX4
Alternative Gene Name: ABHD7, EPHXRP, FLJ90341
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033805: 88%, ENSRNOG00000023389: 85%
Entrez Gene ID: 253152
Uniprot ID: Q8IUS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FPHPNVFTEYILRHPAQLLKSSYYYFFQIPWFPEFMFSINDFKVLKHLFTSHSTGIGRKGCQLTTEDLEAYIYVF
Gene Sequence FPHPNVFTEYILRHPAQLLKSSYYYFFQIPWFPEFMFSINDFKVLKHLFTSHSTGIGRKGCQLTTEDLEAYIYVF
Gene ID - Mouse ENSMUSG00000033805
Gene ID - Rat ENSRNOG00000023389
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPHX4 pAb (ATL-HPA035067)
Datasheet Anti EPHX4 pAb (ATL-HPA035067) Datasheet (External Link)
Vendor Page Anti EPHX4 pAb (ATL-HPA035067) at Atlas Antibodies

Documents & Links for Anti EPHX4 pAb (ATL-HPA035067)
Datasheet Anti EPHX4 pAb (ATL-HPA035067) Datasheet (External Link)
Vendor Page Anti EPHX4 pAb (ATL-HPA035067)