Anti EPHX3 pAb (ATL-HPA012842)
Atlas Antibodies
- Catalog No.:
- ATL-HPA012842-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: EPHX3
Alternative Gene Name: ABHD9, FLJ22408
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037577: 82%, ENSRNOG00000027319: 80%
Entrez Gene ID: 79852
Uniprot ID: Q9H6B9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SELEAFLYNFSQPGGLTGPLNYYRNLFRNFPLEPQELTTPTLLLWGEKDTYLELGLVEAIGSRFVPGRLEAHILPGIGHWIPQSNPQEMHQYMWAFLQDLLD |
Gene Sequence | SELEAFLYNFSQPGGLTGPLNYYRNLFRNFPLEPQELTTPTLLLWGEKDTYLELGLVEAIGSRFVPGRLEAHILPGIGHWIPQSNPQEMHQYMWAFLQDLLD |
Gene ID - Mouse | ENSMUSG00000037577 |
Gene ID - Rat | ENSRNOG00000027319 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EPHX3 pAb (ATL-HPA012842) | |
Datasheet | Anti EPHX3 pAb (ATL-HPA012842) Datasheet (External Link) |
Vendor Page | Anti EPHX3 pAb (ATL-HPA012842) at Atlas Antibodies |
Documents & Links for Anti EPHX3 pAb (ATL-HPA012842) | |
Datasheet | Anti EPHX3 pAb (ATL-HPA012842) Datasheet (External Link) |
Vendor Page | Anti EPHX3 pAb (ATL-HPA012842) |