Anti EPHX3 pAb (ATL-HPA012842)

Atlas Antibodies

SKU:
ATL-HPA012842-25
  • Immunohistochemical staining of human esophagus shows strong cytoplasmic, membranous and nuclear positivity in squamous epithelial cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: epoxide hydrolase 3
Gene Name: EPHX3
Alternative Gene Name: ABHD9, FLJ22408
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037577: 82%, ENSRNOG00000027319: 80%
Entrez Gene ID: 79852
Uniprot ID: Q9H6B9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SELEAFLYNFSQPGGLTGPLNYYRNLFRNFPLEPQELTTPTLLLWGEKDTYLELGLVEAIGSRFVPGRLEAHILPGIGHWIPQSNPQEMHQYMWAFLQDLLD
Gene Sequence SELEAFLYNFSQPGGLTGPLNYYRNLFRNFPLEPQELTTPTLLLWGEKDTYLELGLVEAIGSRFVPGRLEAHILPGIGHWIPQSNPQEMHQYMWAFLQDLLD
Gene ID - Mouse ENSMUSG00000037577
Gene ID - Rat ENSRNOG00000027319
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EPHX3 pAb (ATL-HPA012842)
Datasheet Anti EPHX3 pAb (ATL-HPA012842) Datasheet (External Link)
Vendor Page Anti EPHX3 pAb (ATL-HPA012842) at Atlas Antibodies

Documents & Links for Anti EPHX3 pAb (ATL-HPA012842)
Datasheet Anti EPHX3 pAb (ATL-HPA012842) Datasheet (External Link)
Vendor Page Anti EPHX3 pAb (ATL-HPA012842)