Anti EPHX2 pAb (ATL-HPA023660)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023660-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: EPHX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022040: 75%, ENSRNOG00000017286: 74%
Entrez Gene ID: 2053
Uniprot ID: P34913
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPE |
Gene Sequence | NLKPARDLGMVTILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPE |
Gene ID - Mouse | ENSMUSG00000022040 |
Gene ID - Rat | ENSRNOG00000017286 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EPHX2 pAb (ATL-HPA023660) | |
Datasheet | Anti EPHX2 pAb (ATL-HPA023660) Datasheet (External Link) |
Vendor Page | Anti EPHX2 pAb (ATL-HPA023660) at Atlas Antibodies |
Documents & Links for Anti EPHX2 pAb (ATL-HPA023660) | |
Datasheet | Anti EPHX2 pAb (ATL-HPA023660) Datasheet (External Link) |
Vendor Page | Anti EPHX2 pAb (ATL-HPA023660) |