Anti EPHX2 pAb (ATL-HPA023094)

Atlas Antibodies

Catalog No.:
ATL-HPA023094-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: epoxide hydrolase 2, cytoplasmic
Gene Name: EPHX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022040: 78%, ENSRNOG00000017286: 77%
Entrez Gene ID: 2053
Uniprot ID: P34913
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR
Gene Sequence YRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR
Gene ID - Mouse ENSMUSG00000022040
Gene ID - Rat ENSRNOG00000017286
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPHX2 pAb (ATL-HPA023094)
Datasheet Anti EPHX2 pAb (ATL-HPA023094) Datasheet (External Link)
Vendor Page Anti EPHX2 pAb (ATL-HPA023094) at Atlas Antibodies

Documents & Links for Anti EPHX2 pAb (ATL-HPA023094)
Datasheet Anti EPHX2 pAb (ATL-HPA023094) Datasheet (External Link)
Vendor Page Anti EPHX2 pAb (ATL-HPA023094)