Anti EPHX2 pAb (ATL-HPA023094)

Atlas Antibodies

Catalog No.: ATL-HPA023094-25

Protein Description: epoxide hydrolase 2, cytoplasmic
Gene Name: EPHX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022040: 78%, ENSRNOG00000017286: 77%
Entrez Gene ID: 2053
Uniprot ID: P34913
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR
• Gene Sequence: YRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDAR
• Gene ID - Mouse: ENSMUSG00000022040
• Gene ID - Rat: ENSRNOG00000017286
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.