Anti EPHX1 pAb (ATL-HPA048847 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA048847-25

• 
• 

Protein Description: epoxide hydrolase 1, microsomal (xenobiotic)
Gene Name: EPHX1
Alternative Gene Name: EPHX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038776: 94%, ENSRNOG00000003515: 93%
Entrez Gene ID: 2052
Uniprot ID: P07099
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPAGHTPKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLICTN
• Gene Sequence: LPAGHTPKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYKLMLRLGFQEFYIQGGDWGSLICTN
• Gene ID - Mouse: ENSMUSG00000038776
• Gene ID - Rat: ENSRNOG00000003515
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.