Anti EPHB6 pAb (ATL-HPA035784)

Atlas Antibodies

Catalog No.:
ATL-HPA035784-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: EPH receptor B6
Gene Name: EPHB6
Alternative Gene Name: HEP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029869: 98%, ENSRNOG00000014367: 98%
Entrez Gene ID: 2051
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLY
Gene Sequence LDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLY
Gene ID - Mouse ENSMUSG00000029869
Gene ID - Rat ENSRNOG00000014367
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPHB6 pAb (ATL-HPA035784)
Datasheet Anti EPHB6 pAb (ATL-HPA035784) Datasheet (External Link)
Vendor Page Anti EPHB6 pAb (ATL-HPA035784) at Atlas Antibodies

Documents & Links for Anti EPHB6 pAb (ATL-HPA035784)
Datasheet Anti EPHB6 pAb (ATL-HPA035784) Datasheet (External Link)
Vendor Page Anti EPHB6 pAb (ATL-HPA035784)