Anti EPHA8 pAb (ATL-HPA031433)

Atlas Antibodies

Catalog No.: ATL-HPA031433-25

Protein Description: EPH receptor A8
Gene Name: EPHA8
Alternative Gene Name: EEK, Hek3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028661: 93%, ENSRNOG00000013036: 93%
Entrez Gene ID: 2046
Uniprot ID: P29322
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHPPGKLPEPQFYAQPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGDSG
• Gene Sequence: KRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHPPGKLPEPQFYAQPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGDSG
• Gene ID - Mouse: ENSMUSG00000028661
• Gene ID - Rat: ENSRNOG00000013036
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EPHA8 pAb (ATL-HPA031433) – 1 Found

Liu, Xiaoqin; Xu, Yunzhao; Jin, Qin; Wang, Wei; Zhang, Shu; Wang, Xudong; Zhang, Yuquan; Xu, Xujuan; Huang, Jianfei. EphA8 is a prognostic marker for epithelial ovarian cancer. Oncotarget. 2016;7(15):20801-9.