Anti EPHA8 pAb (ATL-HPA031433)

Atlas Antibodies

SKU:
ATL-HPA031433-25
  • Immunohistochemical staining of human small intestine shows strong membranous positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: EPH receptor A8
Gene Name: EPHA8
Alternative Gene Name: EEK, Hek3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028661: 93%, ENSRNOG00000013036: 93%
Entrez Gene ID: 2046
Uniprot ID: P29322
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHPPGKLPEPQFYAQPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGDSG
Gene Sequence KRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLHHPPGKLPEPQFYAQPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGDSG
Gene ID - Mouse ENSMUSG00000028661
Gene ID - Rat ENSRNOG00000013036
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EPHA8 pAb (ATL-HPA031433)
Datasheet Anti EPHA8 pAb (ATL-HPA031433) Datasheet (External Link)
Vendor Page Anti EPHA8 pAb (ATL-HPA031433) at Atlas Antibodies

Documents & Links for Anti EPHA8 pAb (ATL-HPA031433)
Datasheet Anti EPHA8 pAb (ATL-HPA031433) Datasheet (External Link)
Vendor Page Anti EPHA8 pAb (ATL-HPA031433)



Citations for Anti EPHA8 pAb (ATL-HPA031433) – 1 Found
Liu, Xiaoqin; Xu, Yunzhao; Jin, Qin; Wang, Wei; Zhang, Shu; Wang, Xudong; Zhang, Yuquan; Xu, Xujuan; Huang, Jianfei. EphA8 is a prognostic marker for epithelial ovarian cancer. Oncotarget. 2016;7(15):20801-9.  PubMed