Anti EPB41L4B pAb (ATL-HPA042862)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042862-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: EPB41L4B
Alternative Gene Name: EHM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028434: 91%, ENSRNOG00000056550: 92%
Entrez Gene ID: 54566
Uniprot ID: Q9H329
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PLHININKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVNIQGGKEESPFVNINKKSSLQDASVRSPIPIRVETAQPAVEKPEIKPPRVRKLTRQYSFDEDDLPP |
| Gene Sequence | PLHININKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVNIQGGKEESPFVNINKKSSLQDASVRSPIPIRVETAQPAVEKPEIKPPRVRKLTRQYSFDEDDLPP |
| Gene ID - Mouse | ENSMUSG00000028434 |
| Gene ID - Rat | ENSRNOG00000056550 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EPB41L4B pAb (ATL-HPA042862) | |
| Datasheet | Anti EPB41L4B pAb (ATL-HPA042862) Datasheet (External Link) |
| Vendor Page | Anti EPB41L4B pAb (ATL-HPA042862) at Atlas Antibodies |
| Documents & Links for Anti EPB41L4B pAb (ATL-HPA042862) | |
| Datasheet | Anti EPB41L4B pAb (ATL-HPA042862) Datasheet (External Link) |
| Vendor Page | Anti EPB41L4B pAb (ATL-HPA042862) |
| Citations for Anti EPB41L4B pAb (ATL-HPA042862) – 1 Found |
| Fernandez-Castañer, Elena; Vila-Casadesus, Maria; Vila-Navarro, Elena; Parra, Carolina; Lozano, Juan Jose; Castells, Antoni; Gironella, Meritxell. MicroRNAs Deregulated in Intraductal Papillary Mucinous Neoplasm Converge on Actin Cytoskeleton-Related Pathways That Are Maintained in Pancreatic Ductal Adenocarcinoma. Cancers. 2021;13(10) PubMed |