Anti EPB41L4B pAb (ATL-HPA042862)

Atlas Antibodies

SKU: ATL-HPA042862-25

• 
• 

Protein Description: erythrocyte membrane protein band 4.1 like 4B
Gene Name: EPB41L4B
Alternative Gene Name: EHM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028434: 91%, ENSRNOG00000056550: 92%
Entrez Gene ID: 54566
Uniprot ID: Q9H329
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLHININKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVNIQGGKEESPFVNINKKSSLQDASVRSPIPIRVETAQPAVEKPEIKPPRVRKLTRQYSFDEDDLPP
• Gene Sequence: PLHININKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVNIQGGKEESPFVNINKKSSLQDASVRSPIPIRVETAQPAVEKPEIKPPRVRKLTRQYSFDEDDLPP
• Gene ID - Mouse: ENSMUSG00000028434
• Gene ID - Rat: ENSRNOG00000056550
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EPB41L4B pAb (ATL-HPA042862) – 1 Found

Fernandez-Castañer, Elena; Vila-Casadesus, Maria; Vila-Navarro, Elena; Parra, Carolina; Lozano, Juan Jose; Castells, Antoni; Gironella, Meritxell. MicroRNAs Deregulated in Intraductal Papillary Mucinous Neoplasm Converge on Actin Cytoskeleton-Related Pathways That Are Maintained in Pancreatic Ductal Adenocarcinoma. Cancers. 2021;13(10)