Anti EPB41L4A pAb (ATL-HPA036580)

Atlas Antibodies

Catalog No.:
ATL-HPA036580-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: erythrocyte membrane protein band 4.1 like 4A
Gene Name: EPB41L4A
Alternative Gene Name: NBL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024376: 88%, ENSRNOG00000026050: 89%
Entrez Gene ID: 64097
Uniprot ID: Q9HCS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SNSLSRKLSKFGSIRYKHRYSGRTALQMSRDLSIQLPRPDQNVTRSRSKTYPKRIAQTQPAESNSISRITANMENGENEGTIK
Gene Sequence SNSLSRKLSKFGSIRYKHRYSGRTALQMSRDLSIQLPRPDQNVTRSRSKTYPKRIAQTQPAESNSISRITANMENGENEGTIK
Gene ID - Mouse ENSMUSG00000024376
Gene ID - Rat ENSRNOG00000026050
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPB41L4A pAb (ATL-HPA036580)
Datasheet Anti EPB41L4A pAb (ATL-HPA036580) Datasheet (External Link)
Vendor Page Anti EPB41L4A pAb (ATL-HPA036580) at Atlas Antibodies

Documents & Links for Anti EPB41L4A pAb (ATL-HPA036580)
Datasheet Anti EPB41L4A pAb (ATL-HPA036580) Datasheet (External Link)
Vendor Page Anti EPB41L4A pAb (ATL-HPA036580)