Anti EPB41L4A pAb (ATL-HPA036580)

Atlas Antibodies

SKU: ATL-HPA036580-25

• 

Protein Description: erythrocyte membrane protein band 4.1 like 4A
Gene Name: EPB41L4A
Alternative Gene Name: NBL4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024376: 88%, ENSRNOG00000026050: 89%
Entrez Gene ID: 64097
Uniprot ID: Q9HCS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SNSLSRKLSKFGSIRYKHRYSGRTALQMSRDLSIQLPRPDQNVTRSRSKTYPKRIAQTQPAESNSISRITANMENGENEGTIK
• Gene Sequence: SNSLSRKLSKFGSIRYKHRYSGRTALQMSRDLSIQLPRPDQNVTRSRSKTYPKRIAQTQPAESNSISRITANMENGENEGTIK
• Gene ID - Mouse: ENSMUSG00000024376
• Gene ID - Rat: ENSRNOG00000026050
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.