Anti EPB41L3 pAb (ATL-HPA028605 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA028605-25
  • Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA028605 antibody. Corresponding EPB41L3 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: erythrocyte membrane protein band 4.1-like 3
Gene Name: EPB41L3
Alternative Gene Name: 4.1B, DAL1, KIAA0987
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024044: 58%, ENSRNOG00000016724: 58%
Entrez Gene ID: 23136
Uniprot ID: Q9Y2J2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TESSGIETEPTVHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEGAKEEGGEEVAKAVLE
Gene Sequence TESSGIETEPTVHHLPLSTEKVVQETVLVEERRVVHASGDASYSAGDSGDAAAQPAFTGIKGKEGSALTEGAKEEGGEEVAKAVLE
Gene ID - Mouse ENSMUSG00000024044
Gene ID - Rat ENSRNOG00000016724
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti EPB41L3 pAb (ATL-HPA028605 w/enhanced validation)
Datasheet Anti EPB41L3 pAb (ATL-HPA028605 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EPB41L3 pAb (ATL-HPA028605 w/enhanced validation)