Anti EPB41L2 pAb (ATL-HPA006642)

Atlas Antibodies

Catalog No.:
ATL-HPA006642-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: erythrocyte membrane protein band 4.1-like 2
Gene Name: EPB41L2
Alternative Gene Name: 4.1-G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019978: 65%, ENSRNOG00000012346: 66%
Entrez Gene ID: 2037
Uniprot ID: O43491
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTLVVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKETQEDKLEGGA
Gene Sequence ESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTLVVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKETQEDKLEGGA
Gene ID - Mouse ENSMUSG00000019978
Gene ID - Rat ENSRNOG00000012346
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EPB41L2 pAb (ATL-HPA006642)
Datasheet Anti EPB41L2 pAb (ATL-HPA006642) Datasheet (External Link)
Vendor Page Anti EPB41L2 pAb (ATL-HPA006642) at Atlas Antibodies

Documents & Links for Anti EPB41L2 pAb (ATL-HPA006642)
Datasheet Anti EPB41L2 pAb (ATL-HPA006642) Datasheet (External Link)
Vendor Page Anti EPB41L2 pAb (ATL-HPA006642)
Citations for Anti EPB41L2 pAb (ATL-HPA006642) – 3 Found
Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51.  PubMed
Aristaeus de Asis, Marc; Pires, Manuel; Lyon, Kevin; Vogl, A Wayne. A network of spectrin and plectin surrounds the actin cuffs of apical tubulobulbar complexes in the rat. Spermatogenesis. 2013;3(3):e25733.  PubMed
Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038.  PubMed