Anti EPB41L2 pAb (ATL-HPA006642)
Atlas Antibodies
- Catalog No.:
- ATL-HPA006642-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $303.00
    
         
                            Gene Name: EPB41L2
Alternative Gene Name: 4.1-G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019978: 65%, ENSRNOG00000012346: 66%
Entrez Gene ID: 2037
Uniprot ID: O43491
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | ESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTLVVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKETQEDKLEGGA | 
| Gene Sequence | ESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTLVVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKETQEDKLEGGA | 
| Gene ID - Mouse | ENSMUSG00000019978 | 
| Gene ID - Rat | ENSRNOG00000012346 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti EPB41L2 pAb (ATL-HPA006642) | |
| Datasheet | Anti EPB41L2 pAb (ATL-HPA006642) Datasheet (External Link) | 
| Vendor Page | Anti EPB41L2 pAb (ATL-HPA006642) at Atlas Antibodies | 
| Documents & Links for Anti EPB41L2 pAb (ATL-HPA006642) | |
| Datasheet | Anti EPB41L2 pAb (ATL-HPA006642) Datasheet (External Link) | 
| Vendor Page | Anti EPB41L2 pAb (ATL-HPA006642) | 
| Citations for Anti EPB41L2 pAb (ATL-HPA006642) – 3 Found | 
| Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed | 
| Aristaeus de Asis, Marc; Pires, Manuel; Lyon, Kevin; Vogl, A Wayne. A network of spectrin and plectin surrounds the actin cuffs of apical tubulobulbar complexes in the rat. Spermatogenesis. 2013;3(3):e25733. PubMed | 
| Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038. PubMed | 
 
         
                             
                                        