Anti EPB41 pAb (ATL-HPA028412)

Atlas Antibodies

Catalog No.: ATL-HPA028412-25

Protein Description: erythrocyte membrane protein band 4.1
Gene Name: EPB41
Alternative Gene Name: 4.1R, EL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028906: 83%, ENSRNOG00000010037: 84%
Entrez Gene ID: 2035
Uniprot ID: P11171
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKSLVTEAENSQHQQKEEGEEAINSGQQEPQQEESCQTAAEGDNWCEQKLKASNGDTPTHEDLTKNKERTSESRGLSRLFSSFLKRPKSQVSE
• Gene Sequence: EKSLVTEAENSQHQQKEEGEEAINSGQQEPQQEESCQTAAEGDNWCEQKLKASNGDTPTHEDLTKNKERTSESRGLSRLFSSFLKRPKSQVSE
• Gene ID - Mouse: ENSMUSG00000028906
• Gene ID - Rat: ENSRNOG00000010037
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.