Anti EPB41 pAb (ATL-HPA028076)

Atlas Antibodies

SKU:
ATL-HPA028076-25
  • Immunofluorescent staining of human cell line Hep G2 shows localization to cytosol & cell junctions.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: erythrocyte membrane protein band 4.1
Gene Name: EPB41
Alternative Gene Name: 4.1R, EL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028906: 96%, ENSRNOG00000010037: 96%
Entrez Gene ID: 2035
Uniprot ID: P11171
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESVPEPRPSEWDKRLSTHSPFRTLNINGQIPTGEGPPLVKTQTVTISDNANAVKSEIPTKDVPIVHTETKT
Gene Sequence ESVPEPRPSEWDKRLSTHSPFRTLNINGQIPTGEGPPLVKTQTVTISDNANAVKSEIPTKDVPIVHTETKT
Gene ID - Mouse ENSMUSG00000028906
Gene ID - Rat ENSRNOG00000010037
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EPB41 pAb (ATL-HPA028076)
Datasheet Anti EPB41 pAb (ATL-HPA028076) Datasheet (External Link)
Vendor Page Anti EPB41 pAb (ATL-HPA028076) at Atlas Antibodies

Documents & Links for Anti EPB41 pAb (ATL-HPA028076)
Datasheet Anti EPB41 pAb (ATL-HPA028076) Datasheet (External Link)
Vendor Page Anti EPB41 pAb (ATL-HPA028076)