Anti EP300 pAb (ATL-HPA004112)

Atlas Antibodies

Catalog No.: ATL-HPA004112-25

Protein Description: E1A binding protein p300
Gene Name: EP300
Alternative Gene Name: KAT3B, p300
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055024: 92%, ENSRNOG00000000190: 91%
Entrez Gene ID: 2033
Uniprot ID: Q09472
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQ
• Gene Sequence: TQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQ
• Gene ID - Mouse: ENSMUSG00000055024
• Gene ID - Rat: ENSRNOG00000000190
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.