Anti EP300 pAb (ATL-HPA004112)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004112-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: EP300
Alternative Gene Name: KAT3B, p300
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055024: 92%, ENSRNOG00000000190: 91%
Entrez Gene ID: 2033
Uniprot ID: Q09472
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQ |
| Gene Sequence | TQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQ |
| Gene ID - Mouse | ENSMUSG00000055024 |
| Gene ID - Rat | ENSRNOG00000000190 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EP300 pAb (ATL-HPA004112) | |
| Datasheet | Anti EP300 pAb (ATL-HPA004112) Datasheet (External Link) |
| Vendor Page | Anti EP300 pAb (ATL-HPA004112) at Atlas Antibodies |
| Documents & Links for Anti EP300 pAb (ATL-HPA004112) | |
| Datasheet | Anti EP300 pAb (ATL-HPA004112) Datasheet (External Link) |
| Vendor Page | Anti EP300 pAb (ATL-HPA004112) |