Anti EP300 pAb (ATL-HPA003128)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003128-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: EP300
Alternative Gene Name: KAT3B, p300
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055024: 85%, ENSRNOG00000020862: 35%
Entrez Gene ID: 2033
Uniprot ID: Q09472
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQ |
Gene Sequence | FLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQ |
Gene ID - Mouse | ENSMUSG00000055024 |
Gene ID - Rat | ENSRNOG00000020862 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EP300 pAb (ATL-HPA003128) | |
Datasheet | Anti EP300 pAb (ATL-HPA003128) Datasheet (External Link) |
Vendor Page | Anti EP300 pAb (ATL-HPA003128) at Atlas Antibodies |
Documents & Links for Anti EP300 pAb (ATL-HPA003128) | |
Datasheet | Anti EP300 pAb (ATL-HPA003128) Datasheet (External Link) |
Vendor Page | Anti EP300 pAb (ATL-HPA003128) |
Citations for Anti EP300 pAb (ATL-HPA003128) – 3 Found |
Asaduzzaman, Muhammad; Constantinou, Stephanie; Min, Haoxiang; Gallon, John; Lin, Meng-Lay; Singh, Poonam; Raguz, Selina; Ali, Simak; Shousha, Sami; Coombes, R Charles; Lam, Eric W-F; Hu, Yunhui; Yagüe, Ernesto. Tumour suppressor EP300, a modulator of paclitaxel resistance and stemness, is downregulated in metaplastic breast cancer. Breast Cancer Research And Treatment. 2017;163(3):461-474. PubMed |
Kim, Bo Ram; Coyaud, Etienne; Laurent, Estelle M N; St-Germain, Jonathan; Van de Laar, Emily; Tsao, Ming-Sound; Raught, Brian; Moghal, Nadeem. Identification of the SOX2 Interactome by BioID Reveals EP300 as a Mediator of SOX2-dependent Squamous Differentiation and Lung Squamous Cell Carcinoma Growth. Molecular & Cellular Proteomics : Mcp. 2017;16(10):1864-1888. PubMed |
Liu, Zhenhua; Zhang, Jinghang; Xu, Juntao; Yang, Huijie; Li, Xin; Hou, Yingxiang; Zhao, Yan; Xue, Min; Wang, Beibei; Yu, Na; Yu, Sifan; Niu, Gang; Wu, Gaosong; Li, Xiumin; Wang, Hui; Zhu, Jian; Zhuang, Ting. RNF168 facilitates oestrogen receptor ɑ transcription and drives breast cancer proliferation. Journal Of Cellular And Molecular Medicine. 2018;22(9):4161-4170. PubMed |