Anti ENY2 pAb (ATL-HPA024648)

Atlas Antibodies

Catalog No.:
ATL-HPA024648-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: enhancer of yellow 2 homolog (Drosophila)
Gene Name: ENY2
Alternative Gene Name: DC6, FLJ20480
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022338: 99%, ENSRNOG00000004681: 99%
Entrez Gene ID: 56943
Uniprot ID: Q9NPA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AINQKLMETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRT
Gene Sequence AINQKLMETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRT
Gene ID - Mouse ENSMUSG00000022338
Gene ID - Rat ENSRNOG00000004681
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ENY2 pAb (ATL-HPA024648)
Datasheet Anti ENY2 pAb (ATL-HPA024648) Datasheet (External Link)
Vendor Page Anti ENY2 pAb (ATL-HPA024648) at Atlas Antibodies

Documents & Links for Anti ENY2 pAb (ATL-HPA024648)
Datasheet Anti ENY2 pAb (ATL-HPA024648) Datasheet (External Link)
Vendor Page Anti ENY2 pAb (ATL-HPA024648)