Anti ENY2 pAb (ATL-HPA024648)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024648-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ENY2
Alternative Gene Name: DC6, FLJ20480
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022338: 99%, ENSRNOG00000004681: 99%
Entrez Gene ID: 56943
Uniprot ID: Q9NPA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AINQKLMETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRT |
Gene Sequence | AINQKLMETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRT |
Gene ID - Mouse | ENSMUSG00000022338 |
Gene ID - Rat | ENSRNOG00000004681 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ENY2 pAb (ATL-HPA024648) | |
Datasheet | Anti ENY2 pAb (ATL-HPA024648) Datasheet (External Link) |
Vendor Page | Anti ENY2 pAb (ATL-HPA024648) at Atlas Antibodies |
Documents & Links for Anti ENY2 pAb (ATL-HPA024648) | |
Datasheet | Anti ENY2 pAb (ATL-HPA024648) Datasheet (External Link) |
Vendor Page | Anti ENY2 pAb (ATL-HPA024648) |