Anti ENY2 pAb (ATL-HPA024648)

Atlas Antibodies

SKU: ATL-HPA024648-25

• 
• 

Protein Description: enhancer of yellow 2 homolog (Drosophila)
Gene Name: ENY2
Alternative Gene Name: DC6, FLJ20480
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022338: 99%, ENSRNOG00000004681: 99%
Entrez Gene ID: 56943
Uniprot ID: Q9NPA8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AINQKLMETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRT
• Gene Sequence: AINQKLMETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRT
• Gene ID - Mouse: ENSMUSG00000022338
• Gene ID - Rat: ENSRNOG00000004681
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.