Anti ENTPD5 pAb (ATL-HPA002927 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA002927-100
  • Immunohistochemistry analysis in human liver and skeletal muscle tissues using HPA002927 antibody. Corresponding ENTPD5 RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Liver tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ectonucleoside triphosphate diphosphohydrolase 5
Gene Name: ENTPD5
Alternative Gene Name: CD39L4, NTPDase-5, PCPH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021236: 88%, ENSRNOG00000033206: 87%
Entrez Gene ID: 957
Uniprot ID: O75356
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTL
Gene Sequence AGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTL
Gene ID - Mouse ENSMUSG00000021236
Gene ID - Rat ENSRNOG00000033206
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ENTPD5 pAb (ATL-HPA002927 w/enhanced validation)
Datasheet Anti ENTPD5 pAb (ATL-HPA002927 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ENTPD5 pAb (ATL-HPA002927 w/enhanced validation)



Citations for Anti ENTPD5 pAb (ATL-HPA002927 w/enhanced validation) – 1 Found
Horak, Peter; Tomasich, Erwin; Vaňhara, Petr; Kratochvílová, Kateřina; Anees, Mariam; Marhold, Maximilian; Lemberger, Christof E; Gerschpacher, Marion; Horvat, Reinhard; Sibilia, Maria; Pils, Dietmar; Krainer, Michael. TUSC3 loss alters the ER stress response and accelerates prostate cancer growth in vivo. Scientific Reports. 2014;4( 24435307):3739.  PubMed