Anti ENPP6 pAb (ATL-HPA042740)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042740-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ENPP6
Alternative Gene Name: MGC33971
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038173: 92%, ENSRNOG00000009660: 92%
Entrez Gene ID: 133121
Uniprot ID: Q6UWR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RKLLVFLLDGFRSDYISDEALESLPGFKEIVSRGVKVDYLTPDFPSLSYPNYYTLMTGRHCEVHQMIGNYMWDPTTNKSFDIGVNKDSLMPLWWNGS |
| Gene Sequence | RKLLVFLLDGFRSDYISDEALESLPGFKEIVSRGVKVDYLTPDFPSLSYPNYYTLMTGRHCEVHQMIGNYMWDPTTNKSFDIGVNKDSLMPLWWNGS |
| Gene ID - Mouse | ENSMUSG00000038173 |
| Gene ID - Rat | ENSRNOG00000009660 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ENPP6 pAb (ATL-HPA042740) | |
| Datasheet | Anti ENPP6 pAb (ATL-HPA042740) Datasheet (External Link) |
| Vendor Page | Anti ENPP6 pAb (ATL-HPA042740) at Atlas Antibodies |
| Documents & Links for Anti ENPP6 pAb (ATL-HPA042740) | |
| Datasheet | Anti ENPP6 pAb (ATL-HPA042740) Datasheet (External Link) |
| Vendor Page | Anti ENPP6 pAb (ATL-HPA042740) |
| Citations for Anti ENPP6 pAb (ATL-HPA042740) – 1 Found |
| Polisetty, Ravindra Varma; Gautam, Poonam; Gupta, Manoj Kumar; Sharma, Rakesh; Gowda, Harsha; Renu, Durairaj; Shivakumar, Bhadravathi Marigowda; Lakshmikantha, Akhila; Mariswamappa, Kiran; Ankathi, Praveen; Purohit, Aniruddh K; Uppin, Megha S; Sundaram, Challa; Sirdeshmukh, Ravi. Microsomal membrane proteome of low grade diffuse astrocytomas: Differentially expressed proteins and candidate surveillance biomarkers. Scientific Reports. 2016;6( 27246909):26882. PubMed |