Anti ENPP4 pAb (ATL-HPA016594)

Atlas Antibodies

Catalog No.:
ATL-HPA016594-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ectonucleotide pyrophosphatase/phosphodiesterase 4 (putative)
Gene Name: ENPP4
Alternative Gene Name: KIAA0879, NPP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023961: 88%, ENSRNOG00000010174: 88%
Entrez Gene ID: 22875
Uniprot ID: Q9Y6X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQW
Gene Sequence DEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQW
Gene ID - Mouse ENSMUSG00000023961
Gene ID - Rat ENSRNOG00000010174
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ENPP4 pAb (ATL-HPA016594)
Datasheet Anti ENPP4 pAb (ATL-HPA016594) Datasheet (External Link)
Vendor Page Anti ENPP4 pAb (ATL-HPA016594) at Atlas Antibodies

Documents & Links for Anti ENPP4 pAb (ATL-HPA016594)
Datasheet Anti ENPP4 pAb (ATL-HPA016594) Datasheet (External Link)
Vendor Page Anti ENPP4 pAb (ATL-HPA016594)