Anti ENPP4 pAb (ATL-HPA016594)
Atlas Antibodies
- Catalog No.:
- ATL-HPA016594-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ENPP4
Alternative Gene Name: KIAA0879, NPP4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023961: 88%, ENSRNOG00000010174: 88%
Entrez Gene ID: 22875
Uniprot ID: Q9Y6X5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQW |
Gene Sequence | DEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQW |
Gene ID - Mouse | ENSMUSG00000023961 |
Gene ID - Rat | ENSRNOG00000010174 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ENPP4 pAb (ATL-HPA016594) | |
Datasheet | Anti ENPP4 pAb (ATL-HPA016594) Datasheet (External Link) |
Vendor Page | Anti ENPP4 pAb (ATL-HPA016594) at Atlas Antibodies |
Documents & Links for Anti ENPP4 pAb (ATL-HPA016594) | |
Datasheet | Anti ENPP4 pAb (ATL-HPA016594) Datasheet (External Link) |
Vendor Page | Anti ENPP4 pAb (ATL-HPA016594) |