Anti ENPP3 pAb (ATL-HPA043772 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA043772-25

• 

Protein Description: ectonucleotide pyrophosphatase/phosphodiesterase 3
Gene Name: ENPP3
Alternative Gene Name: B10, CD203c, gp130RB13-6, PD-IBETA, PDNP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019989: 82%, ENSRNOG00000013791: 82%
Entrez Gene ID: 5169
Uniprot ID: O14638
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LHYAKNVRIDKVHLFVDQQWLAVRSKSNTNCGGGNHGYNNEFRSMEAIFLAHGPSFKEKTEVEPFEN
• Gene Sequence: LHYAKNVRIDKVHLFVDQQWLAVRSKSNTNCGGGNHGYNNEFRSMEAIFLAHGPSFKEKTEVEPFEN
• Gene ID - Mouse: ENSMUSG00000019989
• Gene ID - Rat: ENSRNOG00000013791
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ENPP3 pAb (ATL-HPA043772 w/enhanced validation) – 2 Found

Takeda, Taka-Aki; Miyazaki, Shiho; Kobayashi, Miki; Nishino, Katsutoshi; Goto, Tomoko; Matsunaga, Mayu; Ooi, Minami; Shirakawa, Hitoshi; Tani, Fumito; Kawamura, Tatsuyoshi; Komai, Michio; Kambe, Taiho. Zinc deficiency causes delayed ATP clearance and adenosine generation in rats and cell culture models. Communications Biology. 1( 30271993):113. 

Boggavarapu, Nageswara Rao; Lalitkumar, Sujata; Joshua, Vijay; Kasvandik, Sergo; Salumets, Andres; Lalitkumar, Parameswaran Grace; Gemzell-Danielsson, Kristina. Compartmentalized gene expression profiling of receptive endometrium reveals progesterone regulated ENPP3 is differentially expressed and secreted in glycosylated form. Scientific Reports. 2016;6( 27665743):33811.