Anti ENPEP pAb (ATL-HPA005128 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA005128-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: glutamyl aminopeptidase (aminopeptidase A)
Gene Name: ENPEP
Alternative Gene Name: CD249, gp160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028024: 71%, ENSRNOG00000051854: 67%
Entrez Gene ID: 2028
Uniprot ID: Q07075
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SHLPSSTASPSGPPAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVSISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEYVVVE
Gene Sequence SHLPSSTASPSGPPAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVSISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEYVVVE
Gene ID - Mouse ENSMUSG00000028024
Gene ID - Rat ENSRNOG00000051854
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ENPEP pAb (ATL-HPA005128 w/enhanced validation)
Datasheet Anti ENPEP pAb (ATL-HPA005128 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ENPEP pAb (ATL-HPA005128 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ENPEP pAb (ATL-HPA005128 w/enhanced validation)
Datasheet Anti ENPEP pAb (ATL-HPA005128 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ENPEP pAb (ATL-HPA005128 w/enhanced validation)