Anti ENPEP pAb (ATL-HPA005128 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA005128-25

Protein Description: glutamyl aminopeptidase (aminopeptidase A)
Gene Name: ENPEP
Alternative Gene Name: CD249, gp160
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028024: 71%, ENSRNOG00000051854: 67%
Entrez Gene ID: 2028
Uniprot ID: Q07075
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SHLPSSTASPSGPPAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVSISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEYVVVE
• Gene Sequence: SHLPSSTASPSGPPAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVSISINLSAPTRYLWLHLRETRITRLPELKRPSGDQVQVRRCFEYKKQEYVVVE
• Gene ID - Mouse: ENSMUSG00000028024
• Gene ID - Rat: ENSRNOG00000051854
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.