Anti ENOX1 pAb (ATL-HPA038355)

Atlas Antibodies

Catalog No.:
ATL-HPA038355-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ecto-NOX disulfide-thiol exchanger 1
Gene Name: ENOX1
Alternative Gene Name: cCNOX, CNOX, FLJ10094, PIG38
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022012: 96%, ENSRNOG00000047817: 96%
Entrez Gene ID: 55068
Uniprot ID: Q8TC92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TKDQQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQEQLKGTKELVETNGHSHEDSNEINVLTVALVNQDRENNIEKRS
Gene Sequence TKDQQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQEQLKGTKELVETNGHSHEDSNEINVLTVALVNQDRENNIEKRS
Gene ID - Mouse ENSMUSG00000022012
Gene ID - Rat ENSRNOG00000047817
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ENOX1 pAb (ATL-HPA038355)
Datasheet Anti ENOX1 pAb (ATL-HPA038355) Datasheet (External Link)
Vendor Page Anti ENOX1 pAb (ATL-HPA038355) at Atlas Antibodies

Documents & Links for Anti ENOX1 pAb (ATL-HPA038355)
Datasheet Anti ENOX1 pAb (ATL-HPA038355) Datasheet (External Link)
Vendor Page Anti ENOX1 pAb (ATL-HPA038355)
Citations for Anti ENOX1 pAb (ATL-HPA038355) – 1 Found
Jan, Sabrina Z; Vormer, Tinke L; Jongejan, Aldo; Röling, Michael D; Silber, Sherman J; de Rooij, Dirk G; Hamer, Geert; Repping, Sjoerd; van Pelt, Ans M M. Unraveling transcriptome dynamics in human spermatogenesis. Development (Cambridge, England). 2017;144(20):3659-3673.  PubMed