Anti ENOPH1 pAb (ATL-HPA044607 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA044607-25
  • Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-ENOPH1 antibody. Corresponding ENOPH1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & nuclear bodies.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ENOPH1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412010).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: enolase-phosphatase 1
Gene Name: ENOPH1
Alternative Gene Name: E1, MASA, mtnC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029326: 96%, ENSRNOG00000002262: 96%
Entrez Gene ID: 58478
Uniprot ID: Q9UHY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEK
Gene Sequence DILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEK
Gene ID - Mouse ENSMUSG00000029326
Gene ID - Rat ENSRNOG00000002262
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ENOPH1 pAb (ATL-HPA044607 w/enhanced validation)
Datasheet Anti ENOPH1 pAb (ATL-HPA044607 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ENOPH1 pAb (ATL-HPA044607 w/enhanced validation)