Anti ENOPH1 pAb (ATL-HPA044607 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA044607-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: enolase-phosphatase 1
Gene Name: ENOPH1
Alternative Gene Name: E1, MASA, mtnC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029326: 96%, ENSRNOG00000002262: 96%
Entrez Gene ID: 58478
Uniprot ID: Q9UHY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEK
Gene Sequence DILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEK
Gene ID - Mouse ENSMUSG00000029326
Gene ID - Rat ENSRNOG00000002262
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ENOPH1 pAb (ATL-HPA044607 w/enhanced validation)
Datasheet Anti ENOPH1 pAb (ATL-HPA044607 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ENOPH1 pAb (ATL-HPA044607 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ENOPH1 pAb (ATL-HPA044607 w/enhanced validation)
Datasheet Anti ENOPH1 pAb (ATL-HPA044607 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ENOPH1 pAb (ATL-HPA044607 w/enhanced validation)