Anti ENO3 pAb (ATL-HPA000793 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000793-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ENO3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060600: 96%, ENSRNOG00000004078: 98%
Entrez Gene ID: 2027
Uniprot ID: P13929
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ALELLKTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELYKSFIKNYPVVSIEDPFDQDDWATWTSFLSGVNIQIVGDDLTVTN |
| Gene Sequence | ALELLKTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELYKSFIKNYPVVSIEDPFDQDDWATWTSFLSGVNIQIVGDDLTVTN |
| Gene ID - Mouse | ENSMUSG00000060600 |
| Gene ID - Rat | ENSRNOG00000004078 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ENO3 pAb (ATL-HPA000793 w/enhanced validation) | |
| Datasheet | Anti ENO3 pAb (ATL-HPA000793 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ENO3 pAb (ATL-HPA000793 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ENO3 pAb (ATL-HPA000793 w/enhanced validation) | |
| Datasheet | Anti ENO3 pAb (ATL-HPA000793 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ENO3 pAb (ATL-HPA000793 w/enhanced validation) |
| Citations for Anti ENO3 pAb (ATL-HPA000793 w/enhanced validation) – 5 Found |
| Haller, Florian; Bieg, Matthias; Will, Rainer; Körner, Cindy; Weichenhan, Dieter; Bott, Alexander; Ishaque, Naveed; Lutsik, Pavlo; Moskalev, Evgeny A; Mueller, Sarina K; Bähr, Marion; Woerner, Angelika; Kaiser, Birgit; Scherl, Claudia; Haderlein, Marlen; Kleinheinz, Kortine; Fietkau, Rainer; Iro, Heinrich; Eils, Roland; Hartmann, Arndt; Plass, Christoph; Wiemann, Stefan; Agaimy, Abbas. Enhancer hijacking activates oncogenic transcription factor NR4A3 in acinic cell carcinomas of the salivary glands. Nature Communications. 2019;10(1):368. PubMed |
| Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81. PubMed |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |
| Lindskog, Cecilia; Linné, Jerker; Fagerberg, Linn; Hallström, Björn M; Sundberg, Carl Johan; Lindholm, Malene; Huss, Mikael; Kampf, Caroline; Choi, Howard; Liem, David A; Ping, Peipei; Väremo, Leif; Mardinoglu, Adil; Nielsen, Jens; Larsson, Erik; Pontén, Fredrik; Uhlén, Mathias. The human cardiac and skeletal muscle proteomes defined by transcriptomics and antibody-based profiling. Bmc Genomics. 2015;16(1):475. PubMed |
| Signorelli, Mirko; Ayoglu, Burcu; Johansson, Camilla; Lochmüller, Hanns; Straub, Volker; Muntoni, Francesco; Niks, Erik; Tsonaka, Roula; Persson, Anja; Aartsma-Rus, Annemieke; Nilsson, Peter; Al-Khalili Szigyarto, Cristina; Spitali, Pietro. Longitudinal serum biomarker screening identifies malate dehydrogenase 2 as candidate prognostic biomarker for Duchenne muscular dystrophy. Journal Of Cachexia, Sarcopenia And Muscle. 2020;11(2):505-517. PubMed |