Anti ENKD1 pAb (ATL-HPA041478 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA041478-25
  • Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ENKD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410333).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: enkurin domain containing 1
Gene Name: ENKD1
Alternative Gene Name: C16orf48, DKFZP434A1319
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013155: 87%, ENSRNOG00000024364: 92%
Entrez Gene ID: 84080
Uniprot ID: Q9H0I2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QVLAQVLEQQRQAQEHYNATQKGHVPHYLLERRDLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKL
Gene Sequence QVLAQVLEQQRQAQEHYNATQKGHVPHYLLERRDLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKL
Gene ID - Mouse ENSMUSG00000013155
Gene ID - Rat ENSRNOG00000024364
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ENKD1 pAb (ATL-HPA041478 w/enhanced validation)
Datasheet Anti ENKD1 pAb (ATL-HPA041478 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ENKD1 pAb (ATL-HPA041478 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ENKD1 pAb (ATL-HPA041478 w/enhanced validation)
Datasheet Anti ENKD1 pAb (ATL-HPA041478 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ENKD1 pAb (ATL-HPA041478 w/enhanced validation)



Citations for Anti ENKD1 pAb (ATL-HPA041478 w/enhanced validation) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed