Anti ENHO pAb (ATL-HPA042575)

Atlas Antibodies

Catalog No.:
ATL-HPA042575-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: energy homeostasis associated
Gene Name: ENHO
Alternative Gene Name: C9orf165, UNQ470
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028445: 100%, ENSRNOG00000043300: 100%
Entrez Gene ID: 375704
Uniprot ID: Q6UWT2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQ
Gene Sequence SADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQ
Gene ID - Mouse ENSMUSG00000028445
Gene ID - Rat ENSRNOG00000043300
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ENHO pAb (ATL-HPA042575)
Datasheet Anti ENHO pAb (ATL-HPA042575) Datasheet (External Link)
Vendor Page Anti ENHO pAb (ATL-HPA042575) at Atlas Antibodies

Documents & Links for Anti ENHO pAb (ATL-HPA042575)
Datasheet Anti ENHO pAb (ATL-HPA042575) Datasheet (External Link)
Vendor Page Anti ENHO pAb (ATL-HPA042575)