Anti ENGASE pAb (ATL-HPA021551)

Atlas Antibodies

SKU: ATL-HPA021551-25

• 
• 

Protein Description: endo-beta-N-acetylglucosaminidase
Gene Name: ENGASE
Alternative Gene Name: FLJ21865
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033857: 85%, ENSRNOG00000027498: 86%
Entrez Gene ID: 64772
Uniprot ID: Q8NFI3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DKDTTKPISFYLSSLEELLAWKPRLEDGFNVALEPLACRQPPLSSQRPRTLLCHDMMGGYLDDRFIQGSVVQTPYAFYHWQCIDVFVYFSHHTVTIPPVGWTNTAHR
• Gene Sequence: DKDTTKPISFYLSSLEELLAWKPRLEDGFNVALEPLACRQPPLSSQRPRTLLCHDMMGGYLDDRFIQGSVVQTPYAFYHWQCIDVFVYFSHHTVTIPPVGWTNTAHR
• Gene ID - Mouse: ENSMUSG00000033857
• Gene ID - Rat: ENSRNOG00000027498
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ENGASE pAb (ATL-HPA021551) – 1 Found

Na, Hyun-Jin; Abramowitz, Lara K; Hanover, John A. Cytosolic O-GlcNAcylation and PNG1 maintain Drosophila gut homeostasis by regulating proliferation and apoptosis. Plos Genetics. 2022;18(3):e1010128.