Anti EN2 pAb (ATL-HPA045646)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045646-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: EN2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039095: 87%, ENSRNOG00000006846: 87%
Entrez Gene ID: 2020
Uniprot ID: P19622
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SDSPGDGEGGSKTLSLHGGAKKGGDPGGPLDGSLKARGLGGGDLSVSSDSDSSQAGANLGAQPMLWP |
| Gene Sequence | SDSPGDGEGGSKTLSLHGGAKKGGDPGGPLDGSLKARGLGGGDLSVSSDSDSSQAGANLGAQPMLWP |
| Gene ID - Mouse | ENSMUSG00000039095 |
| Gene ID - Rat | ENSRNOG00000006846 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EN2 pAb (ATL-HPA045646) | |
| Datasheet | Anti EN2 pAb (ATL-HPA045646) Datasheet (External Link) |
| Vendor Page | Anti EN2 pAb (ATL-HPA045646) at Atlas Antibodies |
| Documents & Links for Anti EN2 pAb (ATL-HPA045646) | |
| Datasheet | Anti EN2 pAb (ATL-HPA045646) Datasheet (External Link) |
| Vendor Page | Anti EN2 pAb (ATL-HPA045646) |