Anti EN2 pAb (ATL-HPA045646)

Atlas Antibodies

Catalog No.:
ATL-HPA045646-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: engrailed homeobox 2
Gene Name: EN2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039095: 87%, ENSRNOG00000006846: 87%
Entrez Gene ID: 2020
Uniprot ID: P19622
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SDSPGDGEGGSKTLSLHGGAKKGGDPGGPLDGSLKARGLGGGDLSVSSDSDSSQAGANLGAQPMLWP
Gene Sequence SDSPGDGEGGSKTLSLHGGAKKGGDPGGPLDGSLKARGLGGGDLSVSSDSDSSQAGANLGAQPMLWP
Gene ID - Mouse ENSMUSG00000039095
Gene ID - Rat ENSRNOG00000006846
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EN2 pAb (ATL-HPA045646)
Datasheet Anti EN2 pAb (ATL-HPA045646) Datasheet (External Link)
Vendor Page Anti EN2 pAb (ATL-HPA045646) at Atlas Antibodies

Documents & Links for Anti EN2 pAb (ATL-HPA045646)
Datasheet Anti EN2 pAb (ATL-HPA045646) Datasheet (External Link)
Vendor Page Anti EN2 pAb (ATL-HPA045646)