Anti EMX1 pAb (ATL-HPA006421)

Atlas Antibodies

SKU: ATL-HPA006421-25

• 

Protein Description: empty spiracles homeobox 1
Gene Name: EMX1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033726: 97%, ENSRNOG00000015493: 95%
Entrez Gene ID: 2016
Uniprot ID: Q04741
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRI
• Gene Sequence: RSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRI
• Gene ID - Mouse: ENSMUSG00000033726
• Gene ID - Rat: ENSRNOG00000015493
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti EMX1 pAb (ATL-HPA006421) – 6 Found

Quadrato, Giorgia; Nguyen, Tuan; Macosko, Evan Z; Sherwood, John L; Min Yang, Sung; Berger, Daniel R; Maria, Natalie; Scholvin, Jorg; Goldman, Melissa; Kinney, Justin P; Boyden, Edward S; Lichtman, Jeff W; Williams, Ziv M; McCarroll, Steven A; Arlotta, Paola. Cell diversity and network dynamics in photosensitive human brain organoids. Nature. 2017;545(7652):48-53. 

Lancaster, Madeline A; Corsini, Nina S; Wolfinger, Simone; Gustafson, E Hilary; Phillips, Alex W; Burkard, Thomas R; Otani, Tomoki; Livesey, Frederick J; Knoblich, Juergen A. Guided self-organization and cortical plate formation in human brain organoids. Nature Biotechnology. 2017;35(7):659-666. 

Lancaster, Madeline A; Renner, Magdalena; Martin, Carol-Anne; Wenzel, Daniel; Bicknell, Louise S; Hurles, Matthew E; Homfray, Tessa; Penninger, Josef M; Jackson, Andrew P; Knoblich, Juergen A. Cerebral organoids model human brain development and microcephaly. Nature. 2013;501(7467):373-9. 

Velasco, Silvia; Kedaigle, Amanda J; Simmons, Sean K; Nash, Allison; Rocha, Marina; Quadrato, Giorgia; Paulsen, Bruna; Nguyen, Lan; Adiconis, Xian; Regev, Aviv; Levin, Joshua Z; Arlotta, Paola. Individual brain organoids reproducibly form cell diversity of the human cerebral cortex. Nature. 2019;570(7762):523-527. 

Benito-Kwiecinski, Silvia; Giandomenico, Stefano L; Sutcliffe, Magdalena; Riis, Erlend S; Freire-Pritchett, Paula; Kelava, Iva; Wunderlich, Stephanie; Martin, Ulrich; Wray, Gregory A; McDole, Kate; Lancaster, Madeline A. An early cell shape transition drives evolutionary expansion of the human forebrain. Cell. 2021;184(8):2084-2102.e19. 

Rosebrock, Daniel; Arora, Sneha; Mutukula, Naresh; Volkman, Rotem; Gralinska, Elzbieta; Balaskas, Anastasios; Aragonés Hernández, Amèlia; Buschow, René; Brändl, Björn; Müller, Franz-Josef; Arndt, Peter F; Vingron, Martin; Elkabetz, Yechiel. Enhanced cortical neural stem cell identity through short SMAD and WNT inhibition in human cerebral organoids facilitates emergence of outer radial glial cells. Nature Cell Biology. 2022;24(6):981-995.