Anti EMX1 pAb (ATL-HPA006421)
Atlas Antibodies
- Catalog No.:
- ATL-HPA006421-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: EMX1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033726: 97%, ENSRNOG00000015493: 95%
Entrez Gene ID: 2016
Uniprot ID: Q04741
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human, Mouse |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRI |
Gene Sequence | RSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRI |
Gene ID - Mouse | ENSMUSG00000033726 |
Gene ID - Rat | ENSRNOG00000015493 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EMX1 pAb (ATL-HPA006421) | |
Datasheet | Anti EMX1 pAb (ATL-HPA006421) Datasheet (External Link) |
Vendor Page | Anti EMX1 pAb (ATL-HPA006421) at Atlas Antibodies |
Documents & Links for Anti EMX1 pAb (ATL-HPA006421) | |
Datasheet | Anti EMX1 pAb (ATL-HPA006421) Datasheet (External Link) |
Vendor Page | Anti EMX1 pAb (ATL-HPA006421) |
Citations for Anti EMX1 pAb (ATL-HPA006421) – 6 Found |
Quadrato, Giorgia; Nguyen, Tuan; Macosko, Evan Z; Sherwood, John L; Min Yang, Sung; Berger, Daniel R; Maria, Natalie; Scholvin, Jorg; Goldman, Melissa; Kinney, Justin P; Boyden, Edward S; Lichtman, Jeff W; Williams, Ziv M; McCarroll, Steven A; Arlotta, Paola. Cell diversity and network dynamics in photosensitive human brain organoids. Nature. 2017;545(7652):48-53. PubMed |
Lancaster, Madeline A; Corsini, Nina S; Wolfinger, Simone; Gustafson, E Hilary; Phillips, Alex W; Burkard, Thomas R; Otani, Tomoki; Livesey, Frederick J; Knoblich, Juergen A. Guided self-organization and cortical plate formation in human brain organoids. Nature Biotechnology. 2017;35(7):659-666. PubMed |
Lancaster, Madeline A; Renner, Magdalena; Martin, Carol-Anne; Wenzel, Daniel; Bicknell, Louise S; Hurles, Matthew E; Homfray, Tessa; Penninger, Josef M; Jackson, Andrew P; Knoblich, Juergen A. Cerebral organoids model human brain development and microcephaly. Nature. 2013;501(7467):373-9. PubMed |
Velasco, Silvia; Kedaigle, Amanda J; Simmons, Sean K; Nash, Allison; Rocha, Marina; Quadrato, Giorgia; Paulsen, Bruna; Nguyen, Lan; Adiconis, Xian; Regev, Aviv; Levin, Joshua Z; Arlotta, Paola. Individual brain organoids reproducibly form cell diversity of the human cerebral cortex. Nature. 2019;570(7762):523-527. PubMed |
Benito-Kwiecinski, Silvia; Giandomenico, Stefano L; Sutcliffe, Magdalena; Riis, Erlend S; Freire-Pritchett, Paula; Kelava, Iva; Wunderlich, Stephanie; Martin, Ulrich; Wray, Gregory A; McDole, Kate; Lancaster, Madeline A. An early cell shape transition drives evolutionary expansion of the human forebrain. Cell. 2021;184(8):2084-2102.e19. PubMed |
Rosebrock, Daniel; Arora, Sneha; Mutukula, Naresh; Volkman, Rotem; Gralinska, Elzbieta; Balaskas, Anastasios; Aragonés Hernández, Amèlia; Buschow, René; Brändl, Björn; Müller, Franz-Josef; Arndt, Peter F; Vingron, Martin; Elkabetz, Yechiel. Enhanced cortical neural stem cell identity through short SMAD and WNT inhibition in human cerebral organoids facilitates emergence of outer radial glial cells. Nature Cell Biology. 2022;24(6):981-995. PubMed |