Anti EMX1 pAb (ATL-HPA006230)

Atlas Antibodies

Catalog No.:
ATL-HPA006230-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: empty spiracles homeobox 1
Gene Name: EMX1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033726: 97%, ENSRNOG00000015493: 95%
Entrez Gene ID: 2016
Uniprot ID: Q04741
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRI
Gene Sequence RSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRI
Gene ID - Mouse ENSMUSG00000033726
Gene ID - Rat ENSRNOG00000015493
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti EMX1 pAb (ATL-HPA006230)
Datasheet Anti EMX1 pAb (ATL-HPA006230) Datasheet (External Link)
Vendor Page Anti EMX1 pAb (ATL-HPA006230) at Atlas Antibodies

Documents & Links for Anti EMX1 pAb (ATL-HPA006230)
Datasheet Anti EMX1 pAb (ATL-HPA006230) Datasheet (External Link)
Vendor Page Anti EMX1 pAb (ATL-HPA006230)