Anti EMP2 pAb (ATL-HPA014711 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014711-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: EMP2
Alternative Gene Name: XMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022505: 61%, ENSRNOG00000002664: 68%
Entrez Gene ID: 2013
Uniprot ID: P54851
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST |
| Gene Sequence | DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST |
| Gene ID - Mouse | ENSMUSG00000022505 |
| Gene ID - Rat | ENSRNOG00000002664 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti EMP2 pAb (ATL-HPA014711 w/enhanced validation) | |
| Datasheet | Anti EMP2 pAb (ATL-HPA014711 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EMP2 pAb (ATL-HPA014711 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti EMP2 pAb (ATL-HPA014711 w/enhanced validation) | |
| Datasheet | Anti EMP2 pAb (ATL-HPA014711 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti EMP2 pAb (ATL-HPA014711 w/enhanced validation) |
| Citations for Anti EMP2 pAb (ATL-HPA014711 w/enhanced validation) – 4 Found |
| Li, Chien-Feng; Wu, Wen-Jeng; Wu, Wen-Ren; Liao, Yu-Jing; Chen, Lih-Ren; Huang, Chun-Nung; Li, Ching-Chia; Li, Wei-Ming; Huang, Hsuan-Ying; Chen, Yi-Ling; Liang, Shih-Shin; Chow, Nan-Haw; Shiue, Yow-Ling. The cAMP responsive element binding protein 1 transactivates epithelial membrane protein 2, a potential tumor suppressor in the urinary bladder urothelial carcinoma. Oncotarget. 2015;6(11):9220-39. PubMed |
| Chen, Yi-Hsien; Wu, Li-Ching; Wu, Wen-Ren; Lin, Hung-Jung; Lee, Sung-Wei; Lin, Ching-Yih; Chang, Shih-Lun; Chow, Nan-Haw; Huang, Hsuan-Ying; Li, Chien-Feng; Hsu, Han-Ping; Shiue, Yow-Ling. Loss of epithelial membrane protein-2 expression confers an independent prognosticator in nasopharyngeal carcinoma: a cohort study. Bmj Open. 2(2):e000900. PubMed |
| Weinheimer, Viola K; Becher, Anne; Tönnies, Mario; Holland, Gudrun; Knepper, Jessica; Bauer, Torsten T; Schneider, Paul; Neudecker, Jens; Rückert, Jens C; Szymanski, Kolja; Temmesfeld-Wollbrueck, Bettina; Gruber, Achim D; Bannert, Norbert; Suttorp, Norbert; Hippenstiel, Stefan; Wolff, Thorsten; Hocke, Andreas C. Influenza A viruses target type II pneumocytes in the human lung. The Journal Of Infectious Diseases. 2012;206(11):1685-94. PubMed |
| Knepper, Jessica; Schierhorn, Kristina L; Becher, Anne; Budt, Matthias; Tönnies, Mario; Bauer, Torsten T; Schneider, Paul; Neudecker, Jens; Rückert, Jens C; Gruber, Achim D; Suttorp, Norbert; Schweiger, Brunhilde; Hippenstiel, Stefan; Hocke, Andreas C; Wolff, Thorsten. The novel human influenza A(H7N9) virus is naturally adapted to efficient growth in human lung tissue. Mbio. 2013;4(5):e00601-13. PubMed |