Anti EMP2 pAb (ATL-HPA014711 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA014711-25
  • Immunohistochemical staining of human lung shows moderate to strong cytoplasmic positivity in pneumocytes.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
  • Western blot analysis in human cell line MCF-7.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: epithelial membrane protein 2
Gene Name: EMP2
Alternative Gene Name: XMP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022505: 61%, ENSRNOG00000002664: 68%
Entrez Gene ID: 2013
Uniprot ID: P54851
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST
Gene Sequence DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST
Gene ID - Mouse ENSMUSG00000022505
Gene ID - Rat ENSRNOG00000002664
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti EMP2 pAb (ATL-HPA014711 w/enhanced validation)
Datasheet Anti EMP2 pAb (ATL-HPA014711 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EMP2 pAb (ATL-HPA014711 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti EMP2 pAb (ATL-HPA014711 w/enhanced validation)
Datasheet Anti EMP2 pAb (ATL-HPA014711 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EMP2 pAb (ATL-HPA014711 w/enhanced validation)



Citations for Anti EMP2 pAb (ATL-HPA014711 w/enhanced validation) – 4 Found
Li, Chien-Feng; Wu, Wen-Jeng; Wu, Wen-Ren; Liao, Yu-Jing; Chen, Lih-Ren; Huang, Chun-Nung; Li, Ching-Chia; Li, Wei-Ming; Huang, Hsuan-Ying; Chen, Yi-Ling; Liang, Shih-Shin; Chow, Nan-Haw; Shiue, Yow-Ling. The cAMP responsive element binding protein 1 transactivates epithelial membrane protein 2, a potential tumor suppressor in the urinary bladder urothelial carcinoma. Oncotarget. 2015;6(11):9220-39.  PubMed
Chen, Yi-Hsien; Wu, Li-Ching; Wu, Wen-Ren; Lin, Hung-Jung; Lee, Sung-Wei; Lin, Ching-Yih; Chang, Shih-Lun; Chow, Nan-Haw; Huang, Hsuan-Ying; Li, Chien-Feng; Hsu, Han-Ping; Shiue, Yow-Ling. Loss of epithelial membrane protein-2 expression confers an independent prognosticator in nasopharyngeal carcinoma: a cohort study. Bmj Open. 2(2):e000900.  PubMed
Weinheimer, Viola K; Becher, Anne; Tönnies, Mario; Holland, Gudrun; Knepper, Jessica; Bauer, Torsten T; Schneider, Paul; Neudecker, Jens; Rückert, Jens C; Szymanski, Kolja; Temmesfeld-Wollbrueck, Bettina; Gruber, Achim D; Bannert, Norbert; Suttorp, Norbert; Hippenstiel, Stefan; Wolff, Thorsten; Hocke, Andreas C. Influenza A viruses target type II pneumocytes in the human lung. The Journal Of Infectious Diseases. 2012;206(11):1685-94.  PubMed
Knepper, Jessica; Schierhorn, Kristina L; Becher, Anne; Budt, Matthias; Tönnies, Mario; Bauer, Torsten T; Schneider, Paul; Neudecker, Jens; Rückert, Jens C; Gruber, Achim D; Suttorp, Norbert; Schweiger, Brunhilde; Hippenstiel, Stefan; Hocke, Andreas C; Wolff, Thorsten. The novel human influenza A(H7N9) virus is naturally adapted to efficient growth in human lung tissue. Mbio. 2013;4(5):e00601-13.  PubMed